PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00889g02024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 464aa    MW: 51274.2 Da    PI: 7.211
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00889g02024.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.69.1e-071151337
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                               r C+ ++++ + l+C+ ++  lC  C ++ H+       H
  Peinf101Scf00889g02024.1 11 SRPCDFCNQQIAVLYCRADSAKLCLFCDQHVHSAnalskkH 51
                              678***************************99544555555 PP

2zf-B_box24.65.1e-085498341
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                               ++C++++++++++ C +++  lC++C    H +      H+++p
  Peinf101Scf00889g02024.1 54 SQICDNCGSEPVSIRCATDNLVLCQECDWDAHGScvvsgaHDRTP 98
                              579*************************99994488888888877 PP

3CCT64.33.5e-22416459144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               R +a+lRYkeK+ktR+++K+irYesRKa+A++R+RvKGrFvk++
  Peinf101Scf00889g02024.1 416 RGNAMLRYKEKKKTRRYDKHIRYESRKARADTRKRVKGRFVKAN 459
                               7789*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.4E-11956IPR000315B-box-type zinc finger
PROSITE profilePS501199.513956IPR000315B-box-type zinc finger
CDDcd000213.11E-71244No hitNo description
PROSITE profilePS501199.6985299IPR000315B-box-type zinc finger
PfamPF006438.0E-65598IPR000315B-box-type zinc finger
CDDcd000217.33E-75699No hitNo description
SMARTSM003361.35799IPR000315B-box-type zinc finger
PROSITE profilePS5101714.872416458IPR010402CCT domain
PfamPF062032.7E-16416458IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MSSETQKTGE SRPCDFCNQQ IAVLYCRADS AKLCLFCDQH VHSANALSKK HLRSQICDNC  60
GSEPVSIRCA TDNLVLCQEC DWDAHGSCVV SGAHDRTPVE GFTGCPCASE LASAWGLDIE  120
AKNPPPPQSN STNWNGFFDH PSNWMCKDVI PPPSIFLQDL MVPNANNHNN NCGFELSISR  180
KQNPTCGKQK QVILKQLVEL FKRDLADRVG SGGEDLVPRT PNGSSDNWQE NVNLTDGGAV  240
SVTQQVEQPQ QKNVPFTSLL MMQTPHNPKG EDRIVSWSGN SYDQNTQIWD FNLGQLRSHE  300
QSSSMEADYS ESDMAYMMKS YGELIKGTSL AASKGLELSV INCSVAHEDT TGFSNCSNNR  360
GGSQGPATSE SNNLPRIKHS SDSCYAKDLN FSEQSIIVAG ENSGTEILKA DMAKKRGNAM  420
LRYKEKKKTR RYDKHIRYES RKARADTRKR VKGRFVKANN APDG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754445e-95HG975444.1 Solanum pennellii chromosome ch05, complete genome.
GenBankHG9755175e-95HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631919.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
RefseqXP_009631920.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
RefseqXP_009631921.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
RefseqXP_009631922.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 14-like
TrEMBLA0A0V0ID810.0A0A0V0ID81_SOLCH; Putative zinc finger protein CONSTANS-LIKE 15-like (Fragment)
STRINGPGSC0003DMT4000653770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67032126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.11e-100B-box type zinc finger protein with CCT domain